missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human GGTLA1 Partial ORF (NP_004112.1, 510 a.a. - 586 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00002687-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
This gene is a member of a gene family that encodes gamma-glutamyl transpeptidase enzymes. This enzyme consists of a heavy and a light chain, and is able to hydrolyze the gamma-glutamyl moiety of glutathione. It converts leukotriene C4 to leukotriene D4, however, it doesn't convert synthetic substrates that are commonly used to assay gamma-glutamyl transpeptidase. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: GFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGYEspecificaciones
| NP_004112.1 | |
| Liquid | |
| 2687 | |
| GGTLA1 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DKFZp566O011/FLJ92733/GGT-REL/GGTLA1 | |
| GGT5 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.21kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| GFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY | |
| RUO | |
| GGT5 | |
| Wheat Germ (in vitro) | |
| GST |