missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human DSTN Full-length ORF (AAH09477.1, 1 a.a. - 165 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Especificaciones
Número de acceso | AAH09477.1 |
---|---|
Para utilizar con (aplicación) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID de gen (Entrez) | 11034 |
Peso molecular | 44.9kDa |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
16116052
|
Abnova™
H00011034-P02.25UG |
25 ug |
508.00€
25 microgramos |
Fecha estimada de envío: Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
16106052
|
Abnova™
H00011034-P02.10UG |
10 ug |
335.00€
10 microgramos |
Fecha estimada de envío: Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Descripción
The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]
Sequence: MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPVEspecificaciones
AAH09477.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
44.9kDa | |
Glutathione Sepharose 4 Fast Flow | |
MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV | |
RUO | |
DSTN | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, Protein Array, ELISA, Western Blot | |
11034 | |
DSTN (Human) Recombinant Protein (P02) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ACTDP/ADF/bA462D18.2 | |
DSTN | |
Recombinant | |
wheat germ expression system |