missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human DEFB136 Full-length ORF (AAI46564.1, 1 a.a. - 77 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00613209-P02.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Sequence: MATRSVLLALVVLNLLFYVPPGRSGPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDTIHLCCVNPKYLPILTGKEspecificaciones
AAI46564.1 | |
Liquid | |
613209 | |
DEFB136 (Human) Recombinant Protein (P02) | |
12.5% SDS-PAGE Stained with Coomassie Blue | |
MATRSVLLALVVLNLLFYVPPGRSGPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDTIHLCCVNPKYLPILTGK | |
RUO | |
DEFB136 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.42kDa | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DEFB135 | |
DEFB136 | |
Yes | |
wheat germ expression system |