missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DEFB136 Full-length ORF (AAI46564.1, 1 a.a. - 77 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00613209-P02.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16170804

  • 335.00€ / 10 microgramos
Fecha estimada de envío: 17-07-2024
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Sequence: MATRSVLLALVVLNLLFYVPPGRSGPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDTIHLCCVNPKYLPILTGK
Especificaciones

Especificaciones

AAI46564.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.42kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DEFB135
DEFB136
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
613209
DEFB136 (Human) Recombinant Protein (P02)
12.5% SDS-PAGE Stained with Coomassie Blue
MATRSVLLALVVLNLLFYVPPGRSGPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDTIHLCCVNPKYLPILTGK
RUO
DEFB136
Wheat Germ (in vitro)
GST
Liquid
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales