Learn More
Abnova™ Human CTSH Partial ORF (NP_004381.2, 157 a.a. - 235 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00001512-Q02.10ug
Detalles adicionales : Peso : 0.02000kg
Descripción
The protein encoded by this gene is a lysosomal cysteine proteinase important in the overall degradation of lysosomal proteins. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. The encoded protein, which belongs to the peptidase C1 protein family, can act both as an aminopeptidase and as an endopeptidase. Increased expression of this gene has been correlated with malignant progression of prostate tumors. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: ATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEspecificaciones
NP_004381.2 | |
Liquid | |
1512 | |
CTSH (Human) Recombinant Protein (Q02) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ACC-4/ACC-5/CPSB/DKFZp686B24257/MGC1519/minichain | |
CTSH | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
34.43kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
ATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYD | |
RUO | |
CTSH | |
Wheat Germ (in vitro) | |
GST |