missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CROP Full-length ORF (AAH56409.1, 1 a.a. - 79 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00051747-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16170333

  • 508.00€ / 25 microgramos
Fecha estimada de envío: 29-05-2024
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

This gene encodes a protein with an N-terminal half that contains cysteine/histidine motifs and leucine zipper-like repeats, and the C-terminal half is rich in arginine and glutamate residues (RE domain) and arginine and serine residues (RS domain). This protein localizes with a speckled pattern in the nucleus, and could be involved in the formation of splicesome via the RE and RS domains. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Sequence: MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLDVFGRGDNISDVSKFLEDDKWMEE
Especificaciones

Especificaciones

AAH56409.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.6kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LUC7A/OA48-18
CROP
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
51747
CROP (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLDVFGRGDNISDVSKFLEDDKWMEE
RUO
CROP
Wheat Germ (in vitro)
GST
Liquid
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales