missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BMP3 Partial ORF (NP_001192, 373 a.a. - 472 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

335.00€ - 508.00€

Especificaciones

Número de acceso NP_001192
Para utilizar con (aplicación) Antibody Production, ELISA, Protein Array, Western Blot
Formulación 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID de gen (Entrez) 651
Peso molecular 36.74kDa
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16175264
Ver documentos Detalles de la promoción
Abnova™
H00000651-Q01.25UG
25 ug
508.00€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 18-07-2024
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16165264
Ver documentos Detalles de la promoción
Abnova™
H00000651-Q01.10UG
10 ug
335.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 18-07-2024
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

BMP3 belongs to the transforming growth factor-beta (TGFB) superfamily. Bone morphogenic protein, also known as osteogenin, induces bone formation. [provided by RefSeq]

Sequence: RYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
Especificaciones

Especificaciones

NP_001192
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BMP-3A
BMP3
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
651
BMP3 (Human) Recombinant Protein (Q01)
RYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
RUO
BMP3
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documentos

Documentos

Product Certifications