Abnova™ Human BAT4 Partial ORF (NP_149417, 257 a.a. - 356 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human BAT4 Partial ORF (NP_149417, 257 a.a. - 356 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: p-7097266

Used for AP, Array, ELISA, WB-Re

335.00€ - 508.00€

Especificaciones

Número de acceso	NP_149417
Para utilizar con (aplicación)	Antibody Production, ELISA, Protein Array, Western Blot
Formulación	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID de gen (Entrez)	7918
Peso molecular	36.74kDa

Ver más especificaciones

Productos 2

Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
16168065 missing translation for 'viewDocuments' Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00007918-Q01.25UG	25 ug	508.00€ 25 microgramos View alternative products missing translation for 'toSaveUpto' »	Fecha estimada de envío: 19-06-2024 Inicie sesión para ver el stock	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

16158065 missing translation for 'viewDocuments' Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00007918-Q01.10UG	10 ug	335.00€ 10 microgramos View alternative products missing translation for 'toSaveUpto' »	Fecha estimada de envío: 19-06-2024 Inicie sesión para ver el stock	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Description

A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. The protein encoded by this gene is thought to be involved in some aspects of immunity. [provided by RefSeq]

Sequence: SPGFKLLLRGGWEPGMGLGPRGEGRANPIPTVLKRDQEGLGYRSAPQPRVTHFPAWDTRAVAGRERPPRVATLSWREERRREEKDRAWERDLRTYMNLEF

Specifications

Número de acceso	NP_149417
Formulación	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Peso molecular	36.74kDa
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gen	ANKRD59/D6S54E/G5/GPANK1/GPATCH10
Símbolo de gen	BAT4
Recombinante	Recombinant
Sistema de expresión	wheat germ expression system

Para utilizar con (aplicación)	Antibody Production, ELISA, Protein Array, Western Blot
ID de gen (Entrez)	7918
Nombre	BAT4 (Human) Recombinant Protein (Q01)
Inmunógeno	SPGFKLLLRGGWEPGMGLGPRGEGRANPIPTVLKRDQEGLGYRSAPQPRVTHFPAWDTRAVAGRERPPRVATLSWREERRREEKDRAWERDLRTYMNLEF
Estado normativo	RUO
Nombre común	BAT4
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST
Formulario	Liquid

Abnova™ Human BAT4 Partial ORF (NP_149417, 257 a.a. - 356 a.a.) Recombinant Protein with GST-tag at N-terminal

Especificaciones

Description

Specifications

Documents