missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ASXL1 Full-length ORF (AAH64984.1, 1 a.a. - 84 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

335.00€ - 508.00€

Especificaciones

Número de acceso AAH64984.1
Para utilizar con (aplicación) Antibody Production, Protein Array, ELISA, Western Blot
Formulación 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID de gen (Entrez) 171023
Peso molecular 35.9kDa
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16169133
Ver documentos Detalles de la promoción
Abnova™
H00171023-P01.25UG
25 ug
508.00€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 17-07-2024
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16159133
Ver documentos Detalles de la promoción
Abnova™
H00171023-P01.10UG
10 ug
335.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 17-07-2024
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR
Especificaciones

Especificaciones

AAH64984.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.9kDa
Glutathione Sepharose 4 Fast Flow
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA0978/MGC117280/MGC71111
ASXL1
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
171023
ASXL1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
RUO
ASXL1
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documentos

Documentos

Product Certifications