missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Histone Deacetylase 8/HDAC8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 560.70€
Especificaciones
| Antígeno | Histone Deacetylase 8/HDAC8 |
|---|---|
| Dilución | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Aplicaciones | Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18490782
|
Novus Biologicals
NBP2-14085 |
0.1 mL |
 593.00€ 560.70€ / 0.10 ml Ahorro 32.30€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18422312
|
Novus Biologicals
NBP2-14085-25ul |
25 μL |
369.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
Histone Deacetylase 8/HDAC8 Polyclonal antibody specifically detects Histone Deacetylase 8/HDAC8 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Especificaciones
| Histone Deacetylase 8/HDAC8 | |
| Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Breast Cancer, Cancer, Chromatin Research, Epigenetics | |
| PBS (pH 7.2) and 40% Glycerol | |
| 55869 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 3.5.1.98, HD8, HDACL1, histone deacetylase 8, histone deacetylase-like 1, RPD3 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: VLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEF | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto