missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. Histone Deacetylase 8/HDAC8 Antibody, Novus Biologicals™

Histone Deacetylase 8/HDAC8 Antibody, Novus Biologicals™

Código de producto. 18422312 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
Código de producto. Cantidad unitSize
18422312 25 μL 25 microlitros
18490782 0.1 mL 0.10 ml
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18422312

Marca: Novus Biologicals NBP21408525ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Histone Deacetylase 8/HDAC8 Polyclonal antibody specifically detects Histone Deacetylase 8/HDAC8 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antígeno Histone Deacetylase 8/HDAC8
Aplicaciones Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.2) and 40% Glycerol
Alias de gen EC 3.5.1.98, HD8, HDACL1, histone deacetylase 8, histone deacetylase-like 1, RPD3
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to the amino acids: VLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEF
Método de purificación Immunogen affinity purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Breast Cancer, Cancer, Chromatin Research, Epigenetics
Primario o secundario Primary
ID de gen (Entrez) 55869
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.