missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Histone Deacetylase 8/HDAC8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-14085
Código de producto. 18490782
-
593.00€
560.70€ / 0.10 ml
Ahorro 32.30€
5% Descuento
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Histone Deacetylase 8/HDAC8 Polyclonal antibody specifically detects Histone Deacetylase 8/HDAC8 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Especificaciones
| Histone Deacetylase 8/HDAC8 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| EC 3.5.1.98, HD8, HDACL1, histone deacetylase 8, histone deacetylase-like 1, RPD3 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: VLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEF | |
| 0.1 mL | |
| Breast Cancer, Cancer, Chromatin Research, Epigenetics | |
| 55869 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur