Resultados de la búsqueda filtrada
Los productos de algunos de nuestros proveedores no aparecen en los resultados de la búsqueda filtrada. Por favor,
borre todos los filtros
para ver estos productos.
1
–
15
de
944,361
resultados
Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
| Primario o secundario | Primary |
|---|---|
| Método de purificación | Protein G purified |
| Concentración | 0.9 mg/mL |
| Inmunógeno | Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674] |
| Dilución | Western Blot 1:500 |
| Formulario | Purified |
| Clon | XJ11-1B12 |
| Isotype | IgG1 κ |
| Símbolos de los genes | ESPL1 |
| Especie del huésped | Mouse |
| Conjugado | Unconjugated |
| ID de gen (Entrez) | 9700 |
| Antígeno | Separase |
| N.º de referencia del gen | Q14674 |
| Disciplina de investigación | Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators |
| Aplicaciones | Western Blot |
| Contenido y almacenamiento | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Alias de gen | Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase |
| Especies diana | Human |
| Estado normativo | RUO |
| Clasificación | Monoclonal |
| Requisitos de almacenamiento | Store at -80C. Avoid freeze-thaw cycles. |
|---|---|
| Formulación | PBS pH 7.4 |
| Expresión | alpha-Synuclein |
| Símbolo de gen | SNCA |
| Alias de gen | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| ID de gen (Entrez) | 6622 |
| Categoría de investigación | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Grado de pureza o calidad | >95%, by SDS-PAGE |
| Para utilizar con (aplicación) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
Novus Biologicals™ Human HBsAg ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
| Alias de gen | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
|---|---|
| Símbolos de los genes | TP53BP1 |
| Primario o secundario | Primary |
|---|---|
| Método de purificación | Affinity Purified |
| Inmunógeno | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSE |
| Dilución | Western Blot 0.04 - 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, KnockDown Validated |
| Isotype | IgG |
| Símbolos de los genes | RAD52 |
| Especie del huésped | Rabbit |
| Conjugado | Unconjugated |
| ID de gen (Entrez) | 5893 |
| Antígeno | RAD52 |
| Disciplina de investigación | Breast Cancer, DNA Repair, Homologous Recombination |
| Aplicaciones | Western Blot,Immunocytochemistry,Immunofluorescence,KnockDown |
| Alias de gen | DNA repair protein RAD52 homolog, RAD52 (S. cerevisiae) homolog, RAD52 homolog (S. cerevisiae), recombination protein RAD52, rhabdomyosarcoma antigen MU-RMS-40.23 |
| Especificidad de la prueba | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Especies diana | Human |
| Estado normativo | RUO |
| Clasificación | Polyclonal |
| Estado normativo | RUO |
|---|---|
| Especie del huésped | Rabbit |
| Primario o secundario | Primary |
|---|---|
| Formulación | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Método de purificación | Affinity Purified |
| Inmunógeno | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQ |
| Isotype | IgG |
| Símbolos de los genes | DNA2 |
| Especie del huésped | Rabbit |
| Conjugado | Unconjugated |
| ID de gen (Entrez) | 1763 |
| Antígeno | DNA2 |
| Aplicaciones | Immunocytochemistry,Immunofluorescence |
| Alias de gen | DNA replication ATP-dependent helicase-like homolog, DNA replication helicase 2 homolog (yeast), DNA2 DNA replication helicase 2-like (yeast), EC 3.6.1, EC 3.6.4.12, FLJ10063, KIAA0083DNA2LDNA2-like helicase, MGC133297 |
| Especificidad de la prueba | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Especies diana | Human |
| Estado normativo | RUO |
| Clasificación | Polyclonal |
LC3B Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1218 publications
| Método de purificación | Affinity Purified |
|---|---|
| Inmunógeno | Polyclonal LC3B Antibody was made to a synthetic peptide made to an N-terminal portion of the human LC3B protein sequence (between residues 1-100). [UniProt# Q9GZQ8] |
| Dilución | Western Blot 0.5 - 2.0 ug/mL, Simple Western 1:50, Flow Cytometry, ELISA, Immunohistochemistry 1:200 - 1:400, Immunocytochemistry/Immunofluorescence 1:200, Immunoprecipitation 20 ug/500 ug of protein, Immunohistochemistry-Paraffin 1:200 - 1:400, Immunohistochemistry-Frozen, Immunoblotting, Proximity Ligation Assay, SDS-Page, Chromatin Immunoprecipitation (ChIP), Knockout Validated, KnockDown Validated |
| Contenido y almacenamiento | Store at -20°C. |
| Isotype | IgG |
| Símbolos de los genes | MAP1LC3B |
| Especies diana | Pig,Avian,Bacteria,Bovine,Primate,Rabbit,Zebrafish |
| Especie del huésped | Rabbit |
| Primario o secundario | Primary |
|---|---|
| Formulación | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Método de purificación | Affinity Purified |
| Inmunógeno | This antibody was developed against Recombinant Protein corresponding to amino acids:VLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC |
| Dilución | Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:10-1:20, Knockdown Validated |
| Isotype | IgG |
| Símbolos de los genes | PANX1 |
| Especie del huésped | Rabbit |
| Conjugado | Unconjugated |
| ID de gen (Entrez) | 24145 |
| Antígeno | Pannexin-1 |
| Aplicaciones | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Contenido y almacenamiento | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Alias de gen | MGC21309, MRS1innexin, pannexin 1, pannexin-1, PX1, UNQ2529 |
| Especificidad de la prueba | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Especies diana | Human |
| Estado normativo | RUO |
| Clasificación | Polyclonal |
Sirtuin 1/SIRT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
| Primario o secundario | Primary |
|---|---|
| Formulación | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Método de purificación | Affinity Purified |
| Inmunógeno | This antibody was developed against Recombinant Protein corresponding to amino acids:IVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSD |
| Isotype | IgG |
| Símbolos de los genes | SIRT1 |
| Especie del huésped | Rabbit |
| Conjugado | Unconjugated |
| ID de gen (Entrez) | 23411 |
| Antígeno | Sirtuin 1/SIRT1 |
| Disciplina de investigación | Apoptosis, Chromatin Research, DNA Repair, Epigenetics, Histone Deacetylases |
| Contenido y almacenamiento | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Alias de gen | EC 3.5.1, S. cerevisiae, homolog) 1, sirtuin 1 |
| Especificidad de la prueba | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Especies diana | Human |
| Estado normativo | RUO |
| Clasificación | Polyclonal |
Carbonic Anhydrase IX/CA9 Antibody (2D3) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 7 publications
| Primario o secundario | Primary |
|---|---|
| Método de purificación | Protein A or G purified |
| Concentración | 1.0 mg/mL |
| Peso molecular del antígeno | 50 kDa |
| Inmunógeno | Purified recombinant fragment of human Carbonic Anhydrase IX expressed in E. coli. [UniProt# Q16790] |
| Dilución | Western Blot 1:2000, Flow Cytometry 1:200-1:400, ELISA 1:10000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200-1:1000, Flow (Intracellular) 1 ug/mL, CyTOF-ready |
| Formulario | Purified |
| Clon | 2D3 |
| Isotype | IgG1 |
| Símbolos de los genes | CA9 |
| Especie del huésped | Mouse |
| Conjugado | Unconjugated |
| ID de gen (Entrez) | 768 |
| Antígeno | Carbonic Anhydrase IX/CA9 |
| N.º de referencia del gen | Q16790 |
| Disciplina de investigación | Cancer, Cellular Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Signal Transduction |
| Aplicaciones | Western Blot,Flow Cytometry,ELISA,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Contenido y almacenamiento | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Alias de gen | CA-IX, CAIXcarbonic anhydrase 9, Carbonate dehydratase IX, carbonic anhydrase IXpMW1, carbonic dehydratase, EC 4.2.1.1, G250, Membrane antigen MN, MNRCC-associated antigen G250, P54/58N, RCC-associated protein G250, Renal cell carcinoma-associated antigen G250 |
| Especies diana | Human,Mouse |
| Estado normativo | RUO |
| Clasificación | Monoclonal |
| Primario o secundario | Primary |
|---|---|
| Formulación | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Método de purificación | Affinity Purified |
| Inmunógeno | This antibody was developed against Recombinant Protein corresponding to amino acids:TEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPR |
| Dilución | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Isotype | IgG |
| Símbolos de los genes | TMC5 |
| Especie del huésped | Rabbit |
| Conjugado | Unconjugated |
| ID de gen (Entrez) | 79838 |
| Antígeno | TMC5 |
| Aplicaciones | Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Contenido y almacenamiento | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Alias de gen | FLJ13593, transmembrane channel-like 5, transmembrane channel-like protein 5 |
| Especificidad de la prueba | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Especies diana | Human |
| Estado normativo | RUO |
| Clasificación | Polyclonal |
| Primario o secundario | Primary |
|---|---|
| Formulación | PBS (pH 7.3), 50% glycerol |
| Método de purificación | Affinity purified |
| Inmunógeno | Recombinant fusion protein containing a sequence corresponding to amino acids 676-760 of human TMC5 (NP_079056.2). YWQITEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPRA |
| Dilución | Western Blot 1:500-1:2000 |
| Formulario | Purified |
| Isotype | IgG |
| Especie del huésped | Rabbit |
| Conjugado | Unconjugated |
| ID de gen (Entrez) | 79838 |
| Antígeno | TMC5 |
| Disciplina de investigación | Cell Biology |
| Aplicaciones | Western Blot |
| Contenido y almacenamiento | Store at -20°C. Avoid freeze-thaw cycles. |
| Alias de gen | FLJ13593, transmembrane channel-like 5, transmembrane channel-like protein 5 |
| Especies diana | Human |
| Estado normativo | RUO |
| Clasificación | Polyclonal |