missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Reactivos bioquímicos
  4. Péptidos
  5. 18058749

Novus Biologicals™ ZNF786 Recombinant Protein Antigen

Código de producto. 18058749 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0,1 mL
Tamaño de la unidad:
0.10 ml
Código de producto. Cantidad unitSize
18058749 0,1 mL 0.10 ml
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18058749

Marca: Novus Biologicals™ NBP213596PEP

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF786. The ZNF786 Recombinant Protein Antigen is derived from E. coli. The ZNF786 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-13596. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Especificaciones

Gene ID (Entrez) 136051
Especie Human
Método de purificación Chromatography
Pureza >80%
Concentración 0.5mg/mL
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulación PBS and 1M Urea, pH 7.4.
Para utilizar con (aplicación) Blocking/Neutralizing, Control
Símbolo de gen ZNF786
Tipo de etiqueta Unlabeled
Peso molecular 27kDa
Tipo de producto ZNF786
Cantidad 0,1 mL
Estado normativo RUO
Fuente E.Coli
Reactividad específica This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13596. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Inmunógeno EGIPGPRNLDLPGLWDVPAWESTQHPWPVCGESCWENNHLVMHQRGHSKDRTRRAWEKFNKRAETQMPWSSPRVQRH
Mostrar más Mostrar menos

Para uso exclusivo en investigación

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.