missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. ZNF594 Antibody, Novus Biologicals™

ZNF594 Antibody, Novus Biologicals™

Código de producto. 18615194 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μg
25 μg
Unit Size:
100 microlitros
25 microlitros
Product Code. Cantidad unitSize
18615194 25 μg 25 microlitros
18602594 100 μg 100 microlitros
2 options
This item is not returnable. View return policy

Product Code. 18615194

Brand: Novus Biologicals NBP32137225ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ZNF594 Polyclonal antibody specifically detects ZNF594 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antígeno ZNF594
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulación PBS, pH 7.2, 40% glycerol
Alias de gen KIAA1871, Zinc Finger Protein 594, Zinc Finger Protein HZF18
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids: IREMHIIPQKAIVGEIGHGCNEGEKILSAGESSHRYEVSGQNFKQKSGLTEHQK
Método de purificación Affinity purified
Cantidad 25 μg
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 84622
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.