missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
ZFY Polyclonal specifically detects ZFY in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
Especificaciones
| Antígeno | ZFY |
| Aplicaciones | Immunocytochemistry, Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulación | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Alias de gen | MGC138710, zinc finger protein, Y-linked, ZNF911 |
| Símbolos de los genes | ZFY |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KTHIKTKHSKEMPFKCDICLLTFSDTKEVQQHTLVHQESKTHQCLHCD |
| Mostrar más |
For Research Use Only
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?