missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. ZBTB7A/Pokemon Antibody, Novus Biologicals™

ZBTB7A/Pokemon Antibody, Novus Biologicals™

Código de producto. 18609515 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
Código de producto. Cantidad unitSize
18609515 25 μL 25 microlitros
18125078 0.1 mL 0.10 ml
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18609515

Marca: Novus Biologicals NBP23855025ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

ZBTB7A/Pokemon Polyclonal specifically detects ZBTB7A/Pokemon in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno ZBTB7A/Pokemon
Aplicaciones Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
N.º de referencia del gen O95365
Alias de gen DKFZp547O146, Factor binding IST protein 1, Factor that binds to inducer of short transcripts protein 1, FBI-1POK erythroid myeloid ontogenic factor, FBI1TTF-I-interacting peptide 21, HIV-1 inducer of short transcripts binding protein, Leukemia/lymphoma-related factor, LRFHIV-1 1st-binding protein 1, lymphoma related factor, MGC99631, pokemon, TIP21, ZBTB7zinc finger and BTB domain containing 7, zinc finger and BTB domain containing 7A, zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcriptsbinding protein, zinc finger and BTB domain-containing protein 7A, Zinc finger protein 857A, ZNF857APOZ and Krueppel erythroid myeloid ontogenic factor
Símbolos de los genes ZBTB7A
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: AVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSN
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Cancer, Transcription Factors and Regulators
Primario o secundario Primary
ID de gen (Entrez) 51341
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.