missing translation for 'onlineSavingsMsg'
Learn More

WDR68 Antibody, Novus Biologicals™

Código de producto. p-200040738 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
Código de producto. Cantidad unitSize
18435691 25 μL 25 microlitros
18036137 0.1 mL 0.10 ml
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18435691

Marca: Novus Biologicals NBP19259025ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody has been used in 1 publication

WDR68 Polyclonal specifically detects WDR68 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno WDR68
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
N.º de referencia del gen P61962
Alias de gen DDB1 and CUL4 associated factor 7, DDB1- and CUL4-associated factor 7, HAN11AN11, human anthocyanin, seven-WD-repeat protein of the AN11 family-1, SWAN-1, WD repeat domain 68, WD repeat-containing protein 68, WD repeat-containing protein An11 homolog, WDR68, WD-repeat protein
Símbolos de los genes DCAF7
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:YPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQ
Peso molecular del antígeno 39 kDa
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 10238
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.