missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VISTA/B7-H5/PD-1H Antibody (CL3981), Novus Biologicals™
Mouse Monoclonal Antibody
280.00€ - 540.75€
Especificaciones
| Antígeno | VISTA/B7-H5/PD-1H |
|---|---|
| Dilución | Immunohistochemistry-Paraffin 1:1000 - 1:2000 |
| Clasificación | Monoclonal |
| Conjugado | Unconjugated |
| Formulario | Purified |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18215295
|
Novus Biologicals
NBP2-59031 |
100 μL |
572.00€ 540.75€ / 100 microlitros Ahorro 31.25€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18678877
|
Novus Biologicals
NBP2-59031-25ul |
25 μL |
280.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
VISTA/B7-H5/PD-1H Monoclonal specifically detects VISTA/B7-H5/PD-1H in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Especificaciones
| VISTA/B7-H5/PD-1H | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| 64115 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry-Paraffin 1:1000 - 1:2000 | |
| Unconjugated | |
| Mouse | |
| Cancer, Cardiovascular Biology, Immunology | |
| B7H5, B7-H5, C10orf54, chromosome 10 open reading frame 54, GI24, platelet receptor Gi24, PP2135, SISP1, stress induced secreted protein 1, VSIR | |
| C10ORF54 | |
| IgG1 | |
| Protein A purified |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto