missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. VISTA/B7-H5/PD-1H Antibody (CL3981), Novus Biologicals™

VISTA/B7-H5/PD-1H Antibody (CL3981), Novus Biologicals™

Código de producto. 18678877 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
25 μL
100 μL
Tamaño de la unidad:
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18678877 25 μL 25 microlitros
18215295 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18678877 Proveedor Novus Biologicals N.º de proveedor NBP25903125ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Mouse Monoclonal Antibody

VISTA/B7-H5/PD-1H Monoclonal specifically detects VISTA/B7-H5/PD-1H in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno VISTA/B7-H5/PD-1H
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Monoclonal
Conjugado Unconjugated
Dilución Immunohistochemistry-Paraffin 1:1000 - 1:2000
Formulación PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
Alias de gen B7H5, B7-H5, C10orf54, chromosome 10 open reading frame 54, GI24, platelet receptor Gi24, PP2135, SISP1, stress induced secreted protein 1, VSIR
Símbolos de los genes C10ORF54
Especie del huésped Mouse
Inmunógeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS
Método de purificación Protein A purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Cancer, Cardiovascular Biology, Immunology
Primario o secundario Primary
ID de gen (Entrez) 64115
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Formulario Purified
Isotype IgG1
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.