missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GFM1 (aa 373-453) Control Fragment Recombinant Protein

Código de producto. 30204696
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30204696 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30204696

Marca: Invitrogen™ RP102635

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57049 (PA5-57049. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Eukaryotes contain two protein translational systems, one in the cytoplasm and one in the mitochondria. Mitochondrial translation is crucial for maintaining mitochondrial function and mutations in this system lead to a breakdown in the respiratory chain-oxidative phosphorylation system and to impaired maintenance of mitochondrial DNA. This gene encodes one of the mitochondrial translation elongation factors. Its role in the regulation of normal mitochondrial function and in different disease states attributed to mitochondrial dysfunction is not known.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q96RP9
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 85476
Nombre Human GFM1 (aa 373-453) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AW545374; COXPD1; D3Wsu133e; Efg; EF-G; Efg1; EFGM; EF-Gmt; EF-Gmt {ECO:0000255; EGF1; Elongation factor G 1, mitochondrial; elongation factor G 1, mitochondrial {ECO:0000255; elongation factor G, mitochondrial; elongation factor G, mitochondrial {ECO:0000255; Elongation factor G1; elongation factor G1 {ECO:0000255; G elongation factor 1; G elongation factor mitochondrial 1; G elongation factor, mitochondrial 1; G translation elongation factor, mitochondrial; GFM; Gfm1; HAMAP-Rule:MF_03061}; hEFG1; mEF-G 1; mEF-G 1 {ECO:0000255; mitochondrial; mitochondrial elongation factor G; mitochondrial elongation factor G1
Nombre común GFM1
Símbolo de gen GFM1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SYQGELKKGDTIYNTRTRKKVRLQRLARMHADMMEDVEEVYAGDICALFGIDCASGDTFTDKANSGLSMESIHVPDPVISI
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.