Abnova™ UBE2Q Recombinant Protein

Name: Abnova&trade; UBE2Q Recombinant Protein
Brand: Abnova&trade;
SKU: 16171553
Price: 349.00 EUR

Marca: Abnova™ H00055585-P01.10ug

Detalles adicionales : Peso : 0.00010kg

Código de producto. 16171553

Fecha estimada de envío: 31-10-2023
para ver el stock

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Número de acceso	AAH15316
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Peso molecular	33.9
Intervalo de pH	8
Método de purificación	Glutathione Sepharose 4 Fast Flow
Cantidad	10 ug
Inmunógeno	MELLTKQGWSSAYSIESVIMQISATLVKGKARVQFGANKSQYSLTRAQQSYKSLVQIHEKNGWYTPPKEDG
Alias de gen	GTAP/NICE-5/PRO3094/UBE2Q
Símbolo de gen	UBE2Q1
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST

Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
ID de gen (Entrez)	55585
Nombre	UBE2Q (Human) Recombinant Protein (P01)
Método de preparación	In vitro wheat germ expression system
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Fuente	Wheat Germ (in vitro)
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nombre común	UBE2Q1
Reactividad cruzada	Human
Recombinante	Recombinant
Formulario	Solution

Descripción