missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TYW1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-38562-25ul
This item is not returnable.
View return policy
Description
TYW1 Polyclonal specifically detects TYW1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| TYW1 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q9NV66 | |
| TYW1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RELVDLIPEYEIACEHEHSNCLLIAHRKFKIGGEWWTWIDYNRFQELIQEYEDSGGSKTFSAKDYMARTPHWALFGANER | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ10900, MGC23001, MGC60291, Radical S-adenosyl methionine and flavodoxin domain-containing protein 1, radical S-adenosyl methionine and flavodoxin domains 1, RSAFD1, tRNA wybutosine-synthesizing protein 1 homolog, tRNA-yW synthesizing protein 1 homolog (S. cerevisiae), tRNA-yW synthesizing protein 1 homolog A, tRNA-yW-synthesizing protein, TYW1A, YPL207W | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 55253 | |
| Human | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu