missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Twist-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-56209-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Twist-2 Polyclonal specifically detects Twist-2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
| Twist-2 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| BHLHA39, bHLHa39twist-related bHLH protein Dermo1, Class A basic helix-loop-helix protein 39, Dermis-expressed protein 1, Dermo-1, DERMO1MGC117334, twist homolog 2 (Drosophila), twist-related protein 2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| TWIST2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRIL | |
| 25 μL | |
| Inhibitors Activators and Regulators | |
| 117581 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido