missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TTC11 Polyclonal antibody specifically detects TTC11 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Spécification
Spécification
| Antígeno | TTC11 |
| Aplicaciones | ELISA, Western Blot |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Western Blot 1:100 - 1:500, ELISA |
| Formulación | PBS (pH 7.3), 50% glycerol |
| Alias de gen | CGI-135, Fis1, FIS1 homolog, fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae), fission 1 (mitochondrial outer membrane) homolog (yeast), H_NH0132A01.6, hFis1, mitochondrial fission 1 protein, tetratricopeptide repeat domain 11, Tetratricopeptide repeat protein 11, TTC11TPR repeat protein 11 |
| Especie del huésped | Rabbit |
| Inmunógeno | Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human TTC11 (NP_057152.2).,, Sequence:, MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG |
| Método de purificación | Affinity purified |
| Afficher plus |
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?