missing translation for 'onlineSavingsMsg'
Learn More

Tryptophanyl tRNA synthetase Antibody, Novus Biologicals™

Código de producto. p-200104177 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
20 μL
100 μL
Tamaño de la unidad:
100 microlitros
20 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30228727 20 μL 20 microlitros
30231964 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30228727 Proveedor Novus Biologicals N.º de proveedor NBP33336320ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Monoclonal Antibody

Tryptophanyl tRNA synthetase Monoclonal antibody specifically detects Tryptophanyl tRNA synthetase in Human samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Tryptophanyl tRNA synthetase
Aplicaciones ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Monoclonal
Conjugado Unconjugated
Dilución ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.3), 50% glycerol, 0.05% BSA
Alias de gen EC 6.1.1, EC 6.1.1.2, GAMMA-2, hWRS, IFI53, IFP53trpRS, Interferon-induced protein 53, TrpRS, tryptophan tRNA ligase 1, cytoplasmic, Tryptophan--tRNA ligase, tryptophanyl-tRNA synthetase, tryptophanyl-tRNA synthetase, cytoplasmic, WRS
Especie del huésped Rabbit
Inmunógeno A synthetic peptide corresponding to a sequence within amino acids 372-471 of human Tryptophanyl tRNA synthetase (P23381).,, Sequence:, VNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ
Método de purificación Affinity purified
Cantidad 20 μL
Estado normativo RUO
Disciplina de investigación Cell Cycle and Replication
Primario o secundario Primary
ID de gen (Entrez) 7453
Especies diana Human
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.