missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tryptophanyl tRNA synthetase Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Marca: Novus Biologicals NBP3-33363-20ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Tryptophanyl tRNA synthetase Monoclonal antibody specifically detects Tryptophanyl tRNA synthetase in Human samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)
Especificaciones
| Tryptophanyl tRNA synthetase | |
| Monoclonal | |
| ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| EC 6.1.1, EC 6.1.1.2, GAMMA-2, hWRS, IFI53, IFP53trpRS, Interferon-induced protein 53, TrpRS, tryptophan tRNA ligase 1, cytoplasmic, Tryptophan--tRNA ligase, tryptophanyl-tRNA synthetase, tryptophanyl-tRNA synthetase, cytoplasmic, WRS | |
| A synthetic peptide corresponding to a sequence within amino acids 372-471 of human Tryptophanyl tRNA synthetase (P23381).,, Sequence:, VNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ | |
| 20 μL | |
| Cell Cycle and Replication | |
| 7453 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido