missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRPC6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-55831
Código de producto. 18242333
-
593.00€
560.70€ / 100 microlitros
Ahorro 32.30€
5% Descuento
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
TRPC6 Polyclonal specifically detects TRPC6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
| TRPC6 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| FLJ11098, FSGS2, short transient receptor potential channel 6, transient receptor potential cation channel, subfamily C, member 6, Transient receptor protein 6, TRP-6, TRP6FLJ14863, TrpC6 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| TRPC6 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWD | |
| 100 μL | |
| Signal Transduction | |
| 7225 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido