missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Trichohyalin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
409.50€ - 540.75€
Especificaciones
| Antígeno | Trichohyalin |
|---|---|
| Dilución | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Aplicaciones | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18416290
|
Novus Biologicals
NBP1-80687-25ul |
25ul |
433.00€ 409.50€ / 25 microlitros Ahorro 23.50€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18228275
|
Novus Biologicals
NBP1-80687 |
0.1 mL |
572.00€ 540.75€ / 0.10 ml Ahorro 31.25€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
Trichohyalin Polyclonal specifically detects Trichohyalin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Especificaciones
| Trichohyalin | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| THL, TRHY, trichohyalin | |
| TCHH | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q07283 | |
| 7062 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QEKSRREEQELWQEEEQKRRQERERKLREEHIRRQQKEEQRHRQVGEIKSQEGKGHGRLLEPGTHQFASVPVRSSPLYEY | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto