missing translation for 'onlineSavingsMsg'
Learn More

TRF-1 Antibody, Novus Biologicals™

Código de producto. 18252775 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
25 μL
Tamaño de la unidad:
100 microlitros
25 microlitros
Código de producto. Cantidad unitSize
18252775 100 μL 100 microlitros
18604329 25 μL 25 microlitros
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18252775

Marca: Novus Biologicals NBP257285

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

TRF-1 Polyclonal specifically detects TRF-1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno TRF-1
Aplicaciones Immunocytochemistry, Immunofluorescence
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulación PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gen NIMA-interacting protein 2, PIN2hTRF1-AS, Telomeric protein Pin2/TRF1, telomeric repeat binding factor (NIMA-interacting) 1, telomeric repeat binding factor 1, telomeric repeat binding protein 1, telomeric repeat-binding factor 1, TERF1, TRBF1, TRF1FLJ41416, TRFt-TRF1, TTAGGG repeat-binding factor 1
Símbolos de los genes TERF1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FLSKLQHGTQQQDLNKKERRVGTLQSTKKKKESRRATESRIPVSKSQPVTPE
Método de purificación Affinity Purified
Cantidad 100 μL
Estado normativo RUO
Disciplina de investigación Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, Core ESC Like Genes, Stem Cell Markers
Primario o secundario Primary
ID de gen (Entrez) 7013
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.