missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
Translin Polyclonal antibody specifically detects Translin in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Especificaciones
Especificaciones
| Antígeno | Translin |
| Aplicaciones | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulación | PBS (pH 7.3), 50% glycerol |
| Alias de gen | BCLF-1, RCHF1, recombination hotspot associated factor, recombination hotspot-binding protein, REHF-1, TBRBP, translin, TRSLN |
| Especie del huésped | Rabbit |
| Inmunógeno | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Translin (NP_004613.1).,, Sequence:, GFQDIPKRCLKAREHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVTEILGIEPDREKGFHLDVEDYLSGVLILASE |
| Método de purificación | Affinity purified |
| Mostrar más |
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?