missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TopBP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
572.00€
Especificaciones
| Antígeno | TopBP1 |
|---|---|
| Aplicaciones | Immunocytochemistry, Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Especie del huésped | Rabbit |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18210865
|
Novus Biologicals
NBP2-55483 |
100 μL |
572.00€
100 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
TopBP1 Polyclonal specifically detects TopBP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Especificaciones
| TopBP1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DNA topoisomerase II-beta-binding protein 1, DNA topoisomerase II-binding protein 1, KIAA0259DNA topoisomerase 2-binding protein 1, TOP2BP1, TopBP1, topoisomerase (DNA) II binding protein 1 | |
| TOPBP1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 11073 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KYEAAKKWNLPAVTIAWLLETARTGKRADESHFLIENSTKEERSLETEITNGINLNSDTAEHPGTRLQTHRKTVVTPLDMNRFQSKAFRAVVS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto