missing translation for 'onlineSavingsMsg'
Learn More

TopBP1 Antibody, Novus Biologicals™

Product Code. 18210865 Shop All Bio Techne Products
Change view
Click to view available options
Cantidad:
100 μL
Unit Size:
100 microlitros
Product Code. Cantidad unitSize
18210865 100 μL 100 microlitros
1 options
This item is not returnable. View return policy

Product Code. 18210865

Brand: Novus Biologicals NBP255483

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

TopBP1 Polyclonal specifically detects TopBP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antígeno TopBP1
Aplicaciones Immunocytochemistry, Immunofluorescence
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulación PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gen DNA topoisomerase II-beta-binding protein 1, DNA topoisomerase II-binding protein 1, KIAA0259DNA topoisomerase 2-binding protein 1, TOP2BP1, TopBP1, topoisomerase (DNA) II binding protein 1
Símbolos de los genes TOPBP1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KYEAAKKWNLPAVTIAWLLETARTGKRADESHFLIENSTKEERSLETEITNGINLNSDTAEHPGTRLQTHRKTVVTPLDMNRFQSKAFRAVVS
Método de purificación Affinity Purified
Cantidad 100 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 11073
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.