missing translation for 'onlineSavingsMsg'
Learn More

TNNI3K Antibody - BSA Free, Novus Biologicals™

Código de producto. p-200062524 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.02 mL
0.1 mL
Tamaño de la unidad:
0.02 ml
0.10 ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18641542 0.02 mL 0.02 ml
18621892 0.1 mL 0.10 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18641542 Proveedor Novus Biologicals N.º de proveedor NBP2941720.02ml

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

TNNI3K Polyclonal antibody specifically detects TNNI3K in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno TNNI3K
Aplicaciones Western Blot
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 1:500-1:2000
Formulación PBS (pH 7.3), 50% glycerol
Alias de gen CARKCardiac ankyrin repeat kinase, EC 2.7.11.1, MGC142099, MGC33828, serine/threonine-protein kinase TNNI3K, TNNI3 interacting kinase, TNNI3-interacting kinase
Especie del huésped Rabbit
Inmunógeno Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human TNNI3K (NP_057062.1). MGNYKSRPTQTCTDEWKKKVSESYVITIERLEDDLQIKEKELTELRNIFGSDEAFSKVNLNYRTENGLSLLHLCC
Método de purificación Affinity purified
Cantidad 0.02 mL
Estado normativo RUO
Disciplina de investigación Protein Kinase
Primario o secundario Primary
ID de gen (Entrez) 51086
Especies diana Human, Mouse, Rat
Contenido y almacenamiento Store at -20°C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.