missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM65 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
433.00€ - 572.00€
Especificaciones
| Antígeno | TMEM65 |
|---|---|
| Aplicaciones | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Especie del huésped | Rabbit |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18499750
|
Novus Biologicals
NBP1-85970-25ul |
25 μL |
433.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18246026
|
Novus Biologicals
NBP1-85970 |
0.1 mL |
572.00€
0.10 ml |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
TMEM65 Polyclonal specifically detects TMEM65 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Especificaciones
| TMEM65 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| transmembrane protein 65 | |
| TMEM65 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 157378 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EALNTAQGARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEAPPPT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto