missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. TIP60 Antibody, Novus Biologicals™

TIP60 Antibody, Novus Biologicals™

Código de producto. 18467361 Shop All Bio Techne Products
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Cantidad:
0.1 mL
25 μL
missing translation for 'unitSize'
0.10 ml
25 microlitros
Product Code. Cantidad unitSize
18467361 25 μL 25 microlitros
18016974 0.1 mL 0.10 ml
2 missing translation for 'options'
This item is not returnable. View return policy

Product Code. 18467361

missing translation for 'mfr': Novus Biologicals NBP18548225ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 1 publication

TIP60 Polyclonal specifically detects TIP60 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antígeno TIP60
Aplicaciones Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
N.º de referencia del gen Q92993
Alias de gen cPLA2, ESA1EC 2.3.1.48, Histone acetyltransferase HTATIP, histone acetyltransferase KAT5, HIV-1 Tat interactive protein, HIV-1 Tat interactive protein, 60kDa, HTATIP1, HTATIPcPLA2 interacting protein, K(lysine) acetyltransferase 5,60 kDa Tat-interactive protein, K-acetyltransferase 5, Lysine acetyltransferase 5, PLIPTIP, Tat interacting protein, 60kDa, Tip60, TIP60cPLA(2)-interacting protein
Símbolos de los genes KAT5
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:KVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLR
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Disciplina de investigación Apoptosis, DNA Repair
Primario o secundario Primary
ID de gen (Entrez) 10524
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.