missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 18306208

Novus Biologicals TCL1A Antibody (1E8), Novus Biologicals™

Código de producto. 18306208 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mg
Unit Size:
0.01 miligramo
Product Code. Cantidad unitSize
18306208 0.1 mg 0.01 miligramo
1 options
This item is not returnable. View return policy

Product Code. 18306208

Brand: Novus Biologicals H00008115M01

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

TCL1A Monoclonal antibody specifically detects TCL1A in Human samples. It is validated for ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antígeno TCL1A
Aplicaciones ELISA, Sandwich ELISA
Clasificación Monoclonal
Clon 1E8
Conjugado Unconjugated
Dilución ELISA, Sandwich ELISA
Formulación In 1x PBS, pH 7.4
N.º de referencia del gen NP_068801
Alias de gen Oncogene TCL1, Oncogene TCL-1, Protein p14 TCL1, T-cell leukemia/lymphoma 1A, T-cell lymphoma-1, T-cell lymphoma-1A, TCL1T-cell leukemia/lymphoma protein 1A
Especie del huésped Mouse
Inmunógeno TCL1A (NP_068801.1, 61 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Método de purificación IgG purified
Cantidad 0.1 mg
Estado normativo RUO
Disciplina de investigación Cancer
Primario o secundario Primary
ID de gen (Entrez) 8115
Especies diana Human
Contenido y almacenamiento Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.