missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
TBK1 Polyclonal antibody specifically detects TBK1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Especificaciones
Especificaciones
| Antígeno | TBK1 |
| Aplicaciones | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulación | PBS (pH 7.3), 50% glycerol |
| Alias de gen | EC 2.7.11, EC 2.7.11.1, FLJ11330, NAK serine/threonine-protein kinase TBK 1, NAKserine/threonine-protein kinase TBK1, NF-kappa-B-activating kinase, T2K, TANK-binding kinase 1NF-kB-activating kinase, TBK 1 |
| Especie del huésped | Rabbit |
| Inmunógeno | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human TBK1 (NP_037386.1). DIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTH |
| Método de purificación | Affinity purified |
| Mostrar más |
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?