missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. Abnova™ TBCB (Human) Recombinant Protein

Abnova™ TBCB (Human) Recombinant Protein

Código de producto. 16173231
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16173231

Marca: Abnova™ H00001155P01.25ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Human TBCB full-length ORF ( AAH05969, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI

Especificaciones

Número de acceso AAH05969
ID de gen (Entrez) 1155
Nombre tubulin folding cofactor B
Método de preparación Wheat germ expression system
Pruebas de control de calidad 125% SDS-PAGE Stained with Coomassie Blue
Cantidad 25 μg
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gen CG22, CKAP1, CKAPI, MGC14625
Símbolo de gen TBCB
Especie Wheat Germ (in vitro)
Etiqueta de proteína GST
Tampón 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Mostrar más Mostrar menos
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.