missing translation for 'onlineSavingsMsg'
Learn More

T-box 19 Antibody (CL6251), Novus Biologicals™

Código de producto. 18042816 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
25 μL
Tamaño de la unidad:
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18042816 100 μL 100 microlitros
18619888 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18042816 Proveedor Novus Biologicals N.º de proveedor NBP261438

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Mouse Monoclonal Antibody

T-box 19 Monoclonal specifically detects T-box 19 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno T-box 19
Aplicaciones Immunohistochemistry (Paraffin)
Clasificación Monoclonal
Clon CL6251
Conjugado Unconjugated
Dilución Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulación PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gen dJ747L4.1, FLJ26302, FLJ34085, T-box 19, T-box factor, pituitary, T-box protein 19, T-box transcription factor TBX19, TBS 19, TBS19, TPITFLJ34543
Símbolos de los genes TBX19
Especie del huésped Mouse
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG
Método de purificación Protein A purified
Cantidad 100 μL
Primario o secundario Primary
ID de gen (Entrez) 9095
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG1
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.