missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. STING/TMEM173 Antibody, Novus Biologicals™

STING/TMEM173 Antibody, Novus Biologicals™

Código de producto. 18677226 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18677226 0.1 mL 0.10 ml
18638796 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18677226 Proveedor Novus Biologicals N.º de proveedor NBP248684

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

STING/TMEM173 Polyclonal antibody specifically detects STING/TMEM173 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno STING/TMEM173
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200
Formulación PBS (pH 7.2), 40% Glycerol
Alias de gen endoplasmic reticulum IFN stimulator, Endoplasmic reticulum interferon stimulator, ERIS, FLJ38577, hMITA, hSTING, Mediator of IRF3 activation, MITA, mitochondrial mediator of IRF3 activation, MPYS, NET23, N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner, SAVI, Stimulator of interferon genes protein, stimulator of interferon protein, sting, STING-beta, TMEM173, transmembrane protein 173
Especie del huésped Rabbit
Inmunógeno This STING/TMEM173 Antibody was developed against a recombinant protein corresponding to amino acids: RLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVY
Método de purificación Immunogen affinity purified
Cantidad 0.1 mL
Estado normativo RUO
Disciplina de investigación Cancer, Immunology, Innate Immunity
Primario o secundario Primary
ID de gen (Entrez) 340061
Especies diana Human
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.