missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SS18 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-31777
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
SS18 Polyclonal specifically detects SS18 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones
| SS18 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q15532 | |
| SS18 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: NGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMP | |
| 0.1 mL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 6760 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| MGC116875, Protein SYT, SSXTsynovial sarcoma, translocated to X chromosome, Synovial sarcoma translocated to X chromosome protein, synovial sarcoma translocation, chromosome 18, SYTprotein SSXT | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido