missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. SRA1 Antibody, Novus Biologicals™

SRA1 Antibody, Novus Biologicals™

Código de producto. 18158997 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 ml
25 microlitros
Código de producto. Cantidad unitSize
18158997 0.1 mL 0.10 ml
18690636 25 μL 25 microlitros
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18158997

Marca: Novus Biologicals NBP247260

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

SRA1 Polyclonal specifically detects SRA1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno SRA1
Aplicaciones Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen MGC87674, pp7684, SRA, SRAP, steriod receptor RNA activator 1, steriod receptor RNA activator protein, steroid receptor coactivator, steroid receptor RNA activator 1, steroid receptor RNA activator 1 (complexes with NCOA1), Steroid receptor RNA activator protein, STRAA1
Símbolos de los genes SRA1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a recombinant protein corresponding to amino acids: RMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS
Método de purificación Affinity Purified
Cantidad 0.1 mL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 10011
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.