missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
SRA1 Polyclonal specifically detects SRA1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones
Especificaciones
| Antígeno | SRA1 |
| Aplicaciones | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulación | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gen | MGC87674, pp7684, SRA, SRAP, steriod receptor RNA activator 1, steriod receptor RNA activator protein, steroid receptor coactivator, steroid receptor RNA activator 1, steroid receptor RNA activator 1 (complexes with NCOA1), Steroid receptor RNA activator protein, STRAA1 |
| Símbolos de los genes | SRA1 |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against a recombinant protein corresponding to amino acids: RMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS |
| Mostrar más |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?