missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. 18214511

Sphingosine 1 phosphate phosphatase 2 Antibody, Novus Biologicals™

Código de producto. 18214511 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
18214511 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18214511

Marca: Novus Biologicals NBP153181

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

Sphingosine 1 phosphate phosphatase 2 Polyclonal specifically detects Sphingosine 1 phosphate phosphatase 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antígeno Sphingosine 1 phosphate phosphatase 2
Aplicaciones Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Concentración 1 mg/ml
Conjugado Unconjugated
Dilución Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulación PBS, 2% Sucrose with 0.09% Sodium Azide
Alias de gen EC 3.1.3, EC 3.1.3.-, FLJ39004, hSPP2, sphingosine 1-phosphate phosphohydrolase 2, Sphingosine-1-phosphatase 2, sphingosine-1-phosphate phosphatase 2, Spp2, SPP2sphingosine-1-phosphate phosphotase 2, SPPase2
Símbolos de los genes SGPP2
Especie del huésped Rabbit
Inmunógeno Synthetic peptides corresponding to SGPP2(sphingosine-1-phosphate phosphotase 2) The peptide sequence was selected from the C terminal of SGPP2. Peptide sequence SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL.
Peso molecular del antígeno 37 kDa
Método de purificación Protein A purified
Cantidad 100 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 130367
Reconstitución Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Especies diana Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit
Contenido y almacenamiento Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Formulario Purified
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.