missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Sphingosine 1 phosphate phosphatase 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-53181
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Sphingosine 1 phosphate phosphatase 2 Polyclonal specifically detects Sphingosine 1 phosphate phosphatase 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
| Sphingosine 1 phosphate phosphatase 2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| SGPP2 | |
| Synthetic peptides corresponding to SGPP2(sphingosine-1-phosphate phosphotase 2) The peptide sequence was selected from the C terminal of SGPP2. Peptide sequence SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL. | |
| Protein A purified | |
| RUO | |
| 130367 | |
| Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| EC 3.1.3, EC 3.1.3.-, FLJ39004, hSPP2, sphingosine 1-phosphate phosphohydrolase 2, Sphingosine-1-phosphatase 2, sphingosine-1-phosphate phosphatase 2, Spp2, SPP2sphingosine-1-phosphate phosphotase 2, SPPase2 | |
| Rabbit | |
| 37 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido