missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPATA5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 540.75€
Especificaciones
| Antígeno | SPATA5 |
|---|---|
| Aplicaciones | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Especie del huésped | Rabbit |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18118177
|
Novus Biologicals
NBP2-38302 |
0.1 mL |
 572.00€ 540.75€ / 0.10 ml Ahorro 31.25€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18637825
|
Novus Biologicals
NBP2-38302-25ul |
25 μL |
280.00€
25 microlitros |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
SPATA5 Polyclonal specifically detects SPATA5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Especificaciones
| SPATA5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8NB90 | |
| 166378 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SLELSLQLSQLDLEDTQIPTSRSTPYKPIDDRITNKASDVLLDVTQSPGDGSGLMLEEVTGLKCNFESAREGNEQLT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| AFG2ATPase family gene 2 homolog, ATPase family protein 2 homolog, SPAFspermatogenesis associated factor SPAF, spermatogenesis associated 5, Spermatogenesis-associated factor protein, spermatogenesis-associated protein 5 | |
| SPATA5 | |
| IgG | |
| Affinity Purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto