missing translation for 'onlineSavingsMsg'
Learn More
Learn More
solute carrier family 22, member 18 antisense Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-39093
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
solute carrier family 22, member 18 antisense Polyclonal specifically detects solute carrier family 22, member 18 antisense in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones
| solute carrier family 22, member 18 antisense | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q8N1D0 | |
| SLC22A18AS | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGSRLTGGRKG | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| BWR1BSolute carrier family 22 member 18 antisense protein, BWSCR1BBeckwith-Wiedemann region 1B, ORCTL2Sbeckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein, organic cation transporter-like 2 antisense, Organic cation transporter-like protein 2 antisense protein, p27-BWR1Bp27-Beckwith-Wiedemann region 1 B, SLC22A1LSBeckwith-Wiedemann syndrome chromosome region 1, candidate b, solute carrier family 22 (organic cation transporter), member 18 antisense, solute carrier family 22 (organic cation transporter), member 1-like antisense, Solute carrier family 22 member 1-like antisense protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 5003 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido