missing translation for 'onlineSavingsMsg'
Learn More
Learn More
solute carrier family 22, member 18 antisense Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
391.65€ - 590.10€
Especificaciones
| Antígeno | solute carrier family 22, member 18 antisense |
|---|---|
| Aplicaciones | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Especie del huésped | Rabbit |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
18617195
|
Novus Biologicals
NBP2-39093-25ul |
25 μL |
 415.00€ 391.65€ / 25 microlitros Ahorro 23.35€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
|
18194038
|
Novus Biologicals
NBP2-39093 |
0.1 mL |
624.00€ 590.10€ / 0.10 ml Ahorro 33.90€ 5% Descuento |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | |||||
Descripción
solute carrier family 22, member 18 antisense Polyclonal specifically detects solute carrier family 22, member 18 antisense in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Especificaciones
| solute carrier family 22, member 18 antisense | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8N1D0 | |
| 5003 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGSRLTGGRKG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| BWR1BSolute carrier family 22 member 18 antisense protein, BWSCR1BBeckwith-Wiedemann region 1B, ORCTL2Sbeckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein, organic cation transporter-like 2 antisense, Organic cation transporter-like protein 2 antisense protein, p27-BWR1Bp27-Beckwith-Wiedemann region 1 B, SLC22A1LSBeckwith-Wiedemann syndrome chromosome region 1, candidate b, solute carrier family 22 (organic cation transporter), member 18 antisense, solute carrier family 22 (organic cation transporter), member 1-like antisense, Solute carrier family 22 member 1-like antisense protein | |
| SLC22A18AS | |
| IgG | |
| Affinity Purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto