missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
Soluble Liver/Pancreas Antigen Polyclonal specifically detects Soluble Liver/Pancreas Antigen in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
Especificaciones
| Antígeno | Soluble Liver/Pancreas Antigen |
| Aplicaciones | Immunocytochemistry, Immunofluorescence |
| Clasificación | Polyclonal |
| Conjugado | Unconjugated |
| Dilución | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulación | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Alias de gen | EC 2.9.1.2, EC 2.9.1.n1, Liver-pancreas antigen, LPDKFZp434B1417, MGC161491, O-phosphoseryl-tRNA(Sec) selenium transferase, Sec synthase, Selenocysteine synthase, Selenocysteinyl-tRNA(Sec) synthase, Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase, SepSecS, Sep-tRNA:Sec-tRNA synthase, SLA/LP, SLA/LP autoantigen, SLA-p35, SLAUGA suppressor tRNA-associated protein, Soluble liver antigen, soluble liver antigen/liver pancreas antigen, tRNA(Ser/Sec)-associated antigenic protein, TRNP48 |
| Símbolos de los genes | SEPSECS |
| Especie del huésped | Rabbit |
| Inmunógeno | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EKGKCPENGWDESTLELFLHELAIMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKA |
| Mostrar más |
For Research Use Only
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?