missing translation for 'onlineSavingsMsg'
Learn More

Sodium Potassium ATPase Beta 1 Antibody, Novus Biologicals™

Código de producto. 18262170 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
100 μL
25 μL
Tamaño de la unidad:
100 microlitros
25 microlitros
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18262170 100 μL 100 microlitros
18695026 25 μL 25 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Product Code. 18262170 Supplier Novus Biologicals Supplier No. NBP254665

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Sodium Potassium ATPase Beta 1 Polyclonal specifically detects Sodium Potassium ATPase Beta 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antígeno Sodium Potassium ATPase Beta 1
Aplicaciones Western Blot, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Western Blot 0.4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulación PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Alias de gen adenosinetriphosphatase, ATP1B, ATPase, Na+/K+ transporting, beta 1 polypeptide, Beta 1-subunit of Na(+), K(+)-ATPase, MGC1798, Na, K-ATPase beta-1 polypeptide, sodium/potassium-dependent ATPase beta-1 subunit, Sodium/potassium-dependent ATPase subunit beta-1, sodium/potassium-transporting ATPase beta-1 chain, sodium/potassium-transporting ATPase subunit beta-1
Símbolos de los genes ATP1B1
Especie del huésped Rabbit
Inmunógeno This antibody was developed against a Recombinant Protein corresponding to amino acids:SEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPN
Método de purificación Affinity Purified
Cantidad 100 μL
Estado normativo RUO
Disciplina de investigación Cancer, Cellular Markers, Growth and Development, Hypoxia, Neuronal Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction
Primario o secundario Primary
ID de gen (Entrez) 481
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.