missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticuerpos
  4. Anticuerpos primarios
  5. Todos los anticuerpos primarios
  6. SNX26 Antibody, Novus Biologicals™

SNX26 Antibody, Novus Biologicals™

Código de producto. p-200038211 Shop All Bio Techne Products
Change view
Click to view available options
Cantidad:
0.1 mL
25 μL
Unit Size:
0.10 ml
25 microlitros
Product Code. Cantidad unitSize
18401041 25 μL 25 microlitros
18079036 0.1 mL 0.10 ml
2 options
This item is not returnable. View return policy

Product Code. 18401041

Brand: Novus Biologicals NBP19242125ul

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SNX26 Polyclonal specifically detects SNX26 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antígeno SNX26
Aplicaciones Immunohistochemistry, Immunohistochemistry (Paraffin)
Clasificación Polyclonal
Conjugado Unconjugated
Dilución Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulación PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gen FLJ39019, neurite outgrowth multiadaptor RhoGAP protein, NOMA-GAP, Rho GTPase activating protein 33, rho GTPase-activating protein 33, Rho-type GTPase-activating protein 33, sorting nexin 26, Sorting nexin-26, Tc10/CDC42 GTPase-activating protein, TCGAPSNX26
Símbolos de los genes ARHGAP33
Especie del huésped Rabbit
Inmunógeno This antibody was developed against Recombinant Protein corresponding to amino acids:PSECVELFTERPGPGLKADADGPPCGIPAPQGISSLTSAVPRPRGKLAGLLRTFMRSRPSRQRLRQRGIL
Método de purificación Affinity Purified
Cantidad 25 μL
Estado normativo RUO
Primario o secundario Primary
ID de gen (Entrez) 115703
Especificidad de la prueba Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Especies diana Human
Contenido y almacenamiento Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.